Protein Info for Atu5246 in Agrobacterium fabrum C58

Annotation: ABC transporter membrane spanning protein (spermidine/putrescine)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 71 to 94 (24 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 138 to 161 (24 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 237 to 261 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 87 to 256 (170 residues), 43.4 bits, see alignment E=1.7e-15

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 100% identity to atu:Atu5246)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1)" in subsystem Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CLH7 at UniProt or InterPro

Protein Sequence (268 amino acids)

>Atu5246 ABC transporter membrane spanning protein (spermidine/putrescine) (Agrobacterium fabrum C58)
METRSQIRARAFVKAWTAFVVLAVYLPILCGALAGLSKGRYFGFPIRVFSTEWWGKTLAS
LEIQTLVQNSILIAFIVTLVSVILAFFGALAFARYEWKGRKLFQKAILLPVFFPQPVLGL
ALLLWFNALGINPSWQTAVVAHLVWIVPVVTLVIAIQVYSFDPTLEEAARDLGASRWFIL
REITLPILWPGIWSGALFAFLLSWGNFPLSLYTAGVDSTIPKWLYSKMVAGYSPMVPALG
TMSTLSAAALLLAGGLTIMLVRRRQADA