Protein Info for Atu5235 in Agrobacterium fabrum C58

Annotation: ABC transporter membrane spanning protein (amino acid)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 50 to 74 (25 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 142 to 165 (24 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 10 to 107 (98 residues), 68.1 bits, see alignment E=3.9e-23 PF00528: BPD_transp_1" amino acids 30 to 212 (183 residues), 48.5 bits, see alignment E=4.4e-17

Best Hits

Swiss-Prot: 32% identical to YCKA_BACSU: Probable amino-acid ABC transporter permease protein YckA (yckA) from Bacillus subtilis (strain 168)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to atu:Atu5235)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CLI4 at UniProt or InterPro

Protein Sequence (216 amino acids)

>Atu5235 ABC transporter membrane spanning protein (amino acid) (Agrobacterium fabrum C58)
MRQFSFSDLLFLATALEWTFLMAAIALAFGVPLGLALAIARTSGSTVLRVIASAFVELIQ
GIPLLGLLMFFYFGIPVLAGKDVPTVVAVGAAYTIYTAVFLGDIWRGGIQAVRQAQWEAG
ACLGLSWLQQFVHIIGPQAFRIALPATVGFLVQLIKNTSLASVVGLVELARAGQMISAGT
FQPLLVYTLVAAIYFTICFPLTTWSRTLEARLNGAR