Protein Info for Atu5234 in Agrobacterium fabrum C58

Annotation: ABC transporter membrane spanning protein (amino acid)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 66 to 83 (18 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 146 to 168 (23 residues), see Phobius details amino acids 189 to 216 (28 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 15 to 110 (96 residues), 100.5 bits, see alignment E=3e-33 PF00528: BPD_transp_1" amino acids 34 to 217 (184 residues), 71 bits, see alignment E=5.4e-24

Best Hits

Swiss-Prot: 32% identical to GLNP_RICFE: Putative glutamine transport system permease protein GlnP (glnP) from Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to atu:Atu5234)

Predicted SEED Role

"polar amino acid ABC transporter, inner membrane subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CLI5 at UniProt or InterPro

Protein Sequence (222 amino acids)

>Atu5234 ABC transporter membrane spanning protein (amino acid) (Agrobacterium fabrum C58)
MPSFNFRPLWRYEDQFIDGVLTTLLLTVSATAIGLIIGIIGAVVLRSGPKPARIGVRAYI
EIIRNTPALLQIFIIFFVLPTIGLKFSPIHASIVALSIYFGAYASEILRSGLNSIPPSQI
EAGVCLGLTRWQVLSRIVLPPAIRNIYPSMTSQFVLLLLGTSIASQVSTDELFHAAGFID
SRTYRSFEVYALTCGIYFTLVVFFKIVFALVGRAVFRWPTRR