Protein Info for Atu5226 in Agrobacterium fabrum C58

Annotation: 3-oxoadipate enol-lactone hydrolase/4-carboxymuconolactone decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00975: Thioesterase
  • amino acids 24 to 163 (140 residues), 27.8 bits, E=7.3e-10
• PF00561: Abhydrolase_1
  • amino acids 25 to 250 (226 residues), 98.4 bits, E=1.4e-31
• PF12146: Hydrolase_4
  • amino acids 26 to 249 (224 residues), 68.8 bits, E=1.2e-22
• PF12697: Abhydrolase_6
  • amino acids 26 to 256 (231 residues), 68.6 bits, E=3.2e-22
• PF03096: Ndr
  • amino acids 70 to 216 (147 residues), 26.3 bits, E=7.6e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu5226)

Predicted SEED Role

"Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)" in subsystem Catechol branch of beta-ketoadipate pathway or Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 3.1.1.24)

MetaCyc Pathways

• aromatic compounds degradation via β-ketoadipate (8/9 steps found)
• protocatechuate degradation II (ortho-cleavage pathway) (4/4 steps found)
• superpathway of salicylate degradation (6/7 steps found)
• catechol degradation III (ortho-cleavage pathway) (5/6 steps found)
• catechol degradation to β-ketoadipate (3/4 steps found)
• toluene degradation III (aerobic) (via p-cresol) (7/11 steps found)
• 4-methylcatechol degradation (ortho cleavage) (3/7 steps found)
• mandelate degradation to acetyl-CoA (8/18 steps found)
• superpathway of aerobic toluene degradation (12/30 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (15/35 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.24

Use Curated BLAST to search for 3.1.1.24

Sequence Analysis Tools

See A9CLJ2 at UniProt or InterPro

Protein Sequence (270 amino acids)

>Atu5226 3-oxoadipate enol-lactone hydrolase/4-carboxymuconolactone decarboxylase (Agrobacterium fabrum C58)
MGYVGTLKVGEVQLAYRLDGEGSRPLICIHGVGSYKEAWDGVVDPLKNDFTILTFDLRGH
GASSRIKGRYEIEDFVREVIALANHVGFKTFSLAGFSLGGLIAQKLALTHQERVDHLILL
STVAGRTQEEKDRVAGRLAALTAGEPGSHYDASLSRWLTEEFQQNNPDKIARLRARNAEN
DPDCYAAAYRVLAETDLGEELSQIGVPTLIATGEDDSGSNPRMAGFLHSKIANSMLRILP
GLRHSILTEAPELVASIMRDFLNKTRKAHG