Protein Info for Atu5204 in Agrobacterium fabrum C58

Annotation: aldehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 33% identical to BADH_SCHPO: Probable betaine aldehyde dehydrogenase (meu8) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: None (inferred from 100% identity to atu:Atu5204)

MetaCyc: 38% identical to 2-hydroxymuconate-6-semialdehyde dehydrogenase (Paenibacillus sp. JJ-1b)
RXN-8527 [EC: 1.2.1.85]

Predicted SEED Role

"Aldehyde dehydrogenase A (EC 1.2.1.22)" in subsystem L-rhamnose utilization or Methylglyoxal Metabolism (EC 1.2.1.22)

MetaCyc Pathways

L-lactaldehyde degradation (aerobic) (2/2 steps found)
methylglyoxal degradation IV (2/3 steps found)
methylglyoxal degradation V (2/3 steps found)
L-rhamnose degradation II (5/8 steps found)
superpathway of methylglyoxal degradation (5/8 steps found)
lactate biosynthesis (archaea) (2/5 steps found)
protocatechuate degradation III (para-cleavage pathway) (2/5 steps found)
superpathway of fucose and rhamnose degradation (7/12 steps found)
catechol degradation to 2-hydroxypentadienoate II (1/4 steps found)
4-amino-3-hydroxybenzoate degradation (2/6 steps found)
2,3-dihydroxybenzoate degradation (1/5 steps found)
catechol degradation II (meta-cleavage pathway) (2/7 steps found)
meta cleavage pathway of aromatic compounds (4/10 steps found)
toluene degradation IV (aerobic) (via catechol) (5/13 steps found)
superpathway of aerobic toluene degradation (12/30 steps found)
superpathway of aromatic compound degradation via 2-hydroxypentadienoate (11/42 steps found)

KEGG Metabolic Maps

Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.22

Use Curated BLAST to search for 1.2.1.22 or 1.2.1.85

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D3N3 at UniProt or InterPro

Protein Sequence (484 amino acids)

>Atu5204 aldehyde dehydrogenase (Agrobacterium fabrum C58)
MTTFSASNWIDGTFVSSSKRGRSIDPATYETIGDYPDDGGAAAQSAIEAAKRAFRGTAWR
DDAELRARVLDQMASAIERNRERLIDILSLENGKLLGEAALEIDGSPSKLRYWAAMARTE
AGRAKSPKPGSLSVILRQPMGVAGIIVPWNSPVILSVRSFAPALAAGCTVVVKMPGQTAQ
VGSVITEVLAEATDLPEGVVNMFVESGADGAALLVESPDVPTISFTGSTQTGRTIGAIGA
KRMKRFGLELGGKTPMIVFDDADLEAMLPVLEKALTIFAGQFCMTGSRLLVHSSIYELVR
DRLAERLRAVKVGPASDPASDMGPLIDKENVARVDSVVKDALSKGATVVVRGGPVPEGPL
AKGAFFRPSMLEVFDNSLPIVQQETFGPVITIQRFSDEREAVVLANDNDYGLSASVWTRD
LDRSLRVAQALEAGSVFVNDWAKVYDGTEEGGFKQSGLGRLNGVAAIEDFIEYKQVALKP
GLLR