Protein Info for Atu5202 in Agrobacterium fabrum C58
Annotation: alcohol dehydrogenase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K00055, aryl-alcohol dehydrogenase [EC: 1.1.1.90] (inferred from 100% identity to atu:Atu5202)Predicted SEED Role
"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)
MetaCyc Pathways
- 3-methylbutanol biosynthesis (engineered) (6/7 steps found)
- ethanol degradation II (3/3 steps found)
- pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
- acetaldehyde biosynthesis I (1/1 steps found)
- phytol degradation (3/4 steps found)
- L-isoleucine degradation II (2/3 steps found)
- L-leucine degradation III (2/3 steps found)
- L-valine degradation II (2/3 steps found)
- ethanol degradation I (1/2 steps found)
- pyruvate fermentation to ethanol II (1/2 steps found)
- superpathway of anaerobic sucrose degradation (13/19 steps found)
- L-phenylalanine degradation III (2/4 steps found)
- L-tyrosine degradation III (2/4 steps found)
- heterolactic fermentation (12/18 steps found)
- 1,3-dimethylbenzene degradation to 3-methylbenzoate (1/3 steps found)
- 1,4-dimethylbenzene degradation to 4-methylbenzoate (1/3 steps found)
- 3-chlorotoluene degradation II (1/3 steps found)
- L-methionine degradation III (1/3 steps found)
- pyruvate fermentation to ethanol I (1/3 steps found)
- pyruvate fermentation to ethanol III (1/3 steps found)
- toluene degradation to benzoate (1/3 steps found)
- cytidine-5'-diphosphate-glycerol biosynthesis (1/4 steps found)
- salidroside biosynthesis (1/4 steps found)
- serotonin degradation (3/7 steps found)
- mixed acid fermentation (9/16 steps found)
- (S)-propane-1,2-diol degradation (1/5 steps found)
- m-cresol degradation (1/5 steps found)
- acetylene degradation (anaerobic) (1/5 steps found)
- ethanolamine utilization (1/5 steps found)
- phenylethanol biosynthesis (1/5 steps found)
- butanol and isobutanol biosynthesis (engineered) (3/8 steps found)
- salicin biosynthesis (1/6 steps found)
- superpathway of fermentation (Chlamydomonas reinhardtii) (3/9 steps found)
- hexitol fermentation to lactate, formate, ethanol and acetate (10/19 steps found)
- superpathway of N-acetylneuraminate degradation (12/22 steps found)
- superpathway of Clostridium acetobutylicum solventogenic fermentation (5/13 steps found)
- toluene degradation IV (aerobic) (via catechol) (5/13 steps found)
- noradrenaline and adrenaline degradation (4/13 steps found)
- salicortin biosynthesis (1/9 steps found)
- 2,5-xylenol and 3,5-xylenol degradation (3/13 steps found)
- superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (5/17 steps found)
- L-tryptophan degradation V (side chain pathway) (1/13 steps found)
- superpathway of aerobic toluene degradation (12/30 steps found)
KEGG Metabolic Maps
- 1- and 2-Methylnaphthalene degradation
- 3-Chloroacrylic acid degradation
- Biphenyl degradation
- Caprolactam degradation
- Drug metabolism - cytochrome P450
- Fatty acid metabolism
- Glycine, serine and threonine metabolism
- Glycolysis / Gluconeogenesis
- Metabolism of xenobiotics by cytochrome P450
- Phenylalanine metabolism
- Retinol metabolism
- Toluene and xylene degradation
- Tyrosine metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.1.1.1
Use Curated BLAST to search for 1.1.1.1 or 1.1.1.90
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q7D3N5 at UniProt or InterPro
Protein Sequence (372 amino acids)
>Atu5202 alcohol dehydrogenase (Agrobacterium fabrum C58) MTQPATAAVLEEKNGRFILREVKLEAPRPDEVLIRMVATGICATDAHVRQQLMPTPLPAI LGHEGAGIVERVGSTVSHLKPGDHVVLSYHSCGHCKPCMSSHAAYCDHVWETNFAGARLD GTIGVAAPDGNTLHAHFFGQSSFSTYALAHQRNAVKVPDDVPLELLGPLGCGFQTGAGSV LNALKVPVGASIAIFGVGAVGLSAIMAAKVADAAVIIAIDVNTERLKLASELGATHCVNP REQADVASAIRDIAPRGVEYVLDTSGRKENLDGGIGALAPMGQFGFVAFNDHSGAVVDAS RLTVGQSLIGIIQGDAISGLMIPELVGLYRSGRFPFDRLLTFYDFADINEAFDDVAAGRV IKAVLRFPPQAA