Protein Info for Atu5185 in Agrobacterium fabrum C58

Annotation: short chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 15 to 201 (187 residues), 181.9 bits, E=1.9e-57
• PF01370: Epimerase
  • amino acids 17 to 219 (203 residues), 23.4 bits, E=7.4e-09
• PF08659: KR
  • amino acids 18 to 177 (160 residues), 51.6 bits, E=2.2e-17
• PF13561: adh_short_C2
  • amino acids 24 to 253 (230 residues), 218.4 bits, E=2.3e-68

Best Hits

Swiss-Prot: 48% identical to BDCA_ECOLI: Cyclic-di-GMP-binding biofilm dispersal mediator protein (bdcA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to atu:Atu5185)

MetaCyc: 45% identical to A-factor type gamma-butyrolactone 6-reductase (6R-forming) (Streptomyces coelicolor A3(2))
1.1.1.eb [EC: 1.1.1.eb]; 1.1.1.eb [EC: 1.1.1.eb]; 1.1.1.eb [EC: 1.1.1.eb]; 1.1.1.eb [EC: 1.1.1.eb]

Predicted SEED Role

"Enoyl-[acyl-carrier-protein] reductase [NADPH] (EC 1.3.1.10)" in subsystem Fatty Acid Biosynthesis FASII (EC 1.3.1.10)

MetaCyc Pathways

• palmitate biosynthesis III (28/29 steps found)
• anteiso-branched-chain fatty acid biosynthesis (30/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (30/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (30/34 steps found)
• tetradecanoate biosynthesis (mitochondria) (23/25 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (15/16 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (12/12 steps found)
• fatty acid elongation -- saturated (5/5 steps found)
• IM-2 type γ-butyrolactones biosynthesis (2/5 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.3.1.10

Use Curated BLAST to search for 1.1.1.eb or 1.3.1.10

Sequence Analysis Tools

See Q7D3Q2 at UniProt or InterPro

Protein Sequence (254 amino acids)

>Atu5185 short chain dehydrogenase (Agrobacterium fabrum C58)
MIDLTSSRYLPLNGKIALVTGGSRSIGASIAQRLAADGAQVAFTYRGSPAKAEEVAVAIE
KTGARALAIAADAADPDAIRAAVAATVDKFGGLDILVNNAGIAFAGPIDEIAFDDYQAML
AINVTGVFVATQEAVRHMKDGGRIIHIGSSITKYAGVPGLSAYGLTKGAVAGFNRSLAHD
LGPRGITVNTVHPGPTDTDMNPVDGEFAAMQISRIAAGRYGKPREIANVVAFLASPEASF
VTGADIRADGGFTS