Protein Info for Atu5177 in Agrobacterium fabrum C58

Annotation: efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 38 to 378 (341 residues), 154.8 bits, see alignment E=1.4e-49 PF16576: HlyD_D23" amino acids 60 to 264 (205 residues), 59.9 bits, see alignment E=4.5e-20 PF13533: Biotin_lipoyl_2" amino acids 62 to 100 (39 residues), 28.6 bits, see alignment 1.9e-10 PF13437: HlyD_3" amino acids 186 to 268 (83 residues), 40.4 bits, see alignment E=8.4e-14

Best Hits

KEGG orthology group: K13888, macrolide-specific efflux protein MacA (inferred from 100% identity to atu:Atu5177)

Predicted SEED Role

"Macrolide-specific efflux protein MacA" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CLL7 at UniProt or InterPro

Protein Sequence (397 amino acids)

>Atu5177 efflux protein (Agrobacterium fabrum C58)
MTRHITRKRFILAAATLVGLLGVWLLFLRPPAKLELVTAQARTGDIEEVVLATGVLEPLE
LVRVGAQASGRVERLSVEVGDVVEAGQLVAEIDSQTRRNTLRDREAALANIRAVHAARMA
GLVKARKDFERERELLAGGSIPRAQYDAAVATLDSARAEVQALDAQITQAQVALASADIE
LGYTRITAPIAGTVVAIVTEEGQTVNALQTAPTIVMIARLDRMKVRADISEADVVRVRRG
MPVWFSILGDPKRRFDGELRQVEPAPASIANDGSSAARELGSTKGAVYYTGLIDVANADG
VLRPSMTAQVSIVLSRVSGAVLAPLSAVEGAPRAGDTARIRVLDAASEVQIRQVQVGVDN
GADIQILSGLQAGETIVLGASTDERTDGQAQLAAAKR