Protein Info for Atu5172 in Agrobacterium fabrum C58

Annotation: type IV secretion protein AvhB11

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 TIGR02788: P-type DNA transfer ATPase VirB11" amino acids 20 to 328 (309 residues), 446 bits, see alignment E=2.9e-138 PF00437: T2SSE" amino acids 69 to 312 (244 residues), 93.9 bits, see alignment E=4.2e-31

Best Hits

KEGG orthology group: K03196, type IV secretion system protein VirB11 (inferred from 100% identity to atu:Atu5172)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D3R2 at UniProt or InterPro

Protein Sequence (336 amino acids)

>Atu5172 type IV secretion protein AvhB11 (Agrobacterium fabrum C58)
MSERQESAVVSELLKPFSTFLQDKSLLEVIVNRPGQVLTEGPGGWRTYEMPELTFEKLMR
LARAVASFSHQSIDETRPILSATLPGNERIQIVIPPATINDTVSMTIRKPSSVDFSLDDL
EEKGFFQTACAATSTSSSAQDEELCETYRAGRFKDFLRQAVIARKNIIISGATGSAKTTL
SKALIKHIPENERVISIEDTPELVISQPNHVRLFYSKGRQGLSRAGPKELLESCLRMRPD
RILLQELRDGTAFYYIRNVNSGHPGSITTVHANSAELAFEQLVLLVKESEGVAGLDRADI
VALLKASIDIVAQCRRNKGNFRLSEVYFRCERKAKD