Protein Info for Atu5167 in Agrobacterium fabrum C58

Annotation: type IV secretion protein AvhB6

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 transmembrane" amino acids 30 to 51 (22 residues), see Phobius details amino acids 62 to 79 (18 residues), see Phobius details amino acids 137 to 159 (23 residues), see Phobius details amino acids 166 to 186 (21 residues), see Phobius details amino acids 198 to 220 (23 residues), see Phobius details amino acids 232 to 251 (20 residues), see Phobius details amino acids 256 to 272 (17 residues), see Phobius details PF04610: TrbL" amino acids 39 to 252 (214 residues), 163.3 bits, see alignment E=3.7e-52

Best Hits

KEGG orthology group: K03201, type IV secretion system protein VirB6 (inferred from 99% identity to agr:AGROH133_14798)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D3R7 at UniProt or InterPro

Protein Sequence (311 amino acids)

>Atu5167 type IV secretion protein AvhB6 (Agrobacterium fabrum C58)
MYQVFEFIDGQFKRPLEIFVSDGTSNIAEWVAGPLTVAVTLYVVLYGYLILRGSVQEPIL
DFAFRAMKLAIIVMLVKNAGEYQTYVTNIFFDVLPREIAQALNAGTAPSASTFDSLLDKG
QASATDIWTRASWPIDIVTGVGGIMVIGVSFLVAGIGYVVSLYARLALAIVLAIGPIFIA
LAMFQSTRRFTESWIGQLANFVILQVLVVAVGSLLISCLDSTFTAIDSYSDVLMRPIAFC
AIGIAALYIFYQLPGIASALASGGASLVYGYTTARDAHEGMLARAASHTGRMIGRGARFA
RRAFGSRNAGV