Protein Info for Atu5156 in Agrobacterium fabrum C58

Annotation: short chain dehydrogenase dehydrogenases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF00106: adh_short" amino acids 7 to 205 (199 residues), 163.9 bits, see alignment E=6.6e-52 PF08659: KR" amino acids 7 to 148 (142 residues), 42 bits, see alignment E=1.9e-14 PF01370: Epimerase" amino acids 8 to 183 (176 residues), 23 bits, see alignment E=1e-08 PF13561: adh_short_C2" amino acids 12 to 208 (197 residues), 118.9 bits, see alignment E=5.4e-38

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu5156)

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D3S6 at UniProt or InterPro

Protein Sequence (248 amino acids)

>Atu5156 short chain dehydrogenase dehydrogenases (Agrobacterium fabrum C58)
MTHTPPTALVTGANKGIGLAIARQLGAAGHTVWLGCRDMSRGEMAAFELRENGVDARAVQ
LDVTDDASASSAAKTIESEVGHLDVLVNNAGLMFGSPPSLAEESIDEIQQMFNTNVFGVM
RVTQAFLPLLRKSKAARIVMMSSGLSSLTDALDMRSETWTVGFGGYCASKTALNMLTVKL
AKELDREGIKVNAVDPGLTSTDMTGNGPGHSPEDGARPAFALATTHAYGPTAGFYACAPS
GELVQKSW