Protein Info for Atu5147 in Agrobacterium fabrum C58

Annotation: Mg(2+) transport ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 transmembrane" amino acids 49 to 69 (21 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 110 to 128 (19 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details amino acids 162 to 180 (19 residues), see Phobius details PF02308: MgtC" amino acids 57 to 178 (122 residues), 124.1 bits, see alignment E=2.2e-40

Best Hits

KEGG orthology group: K07507, putative Mg2+ transporter-C (MgtC) family protein (inferred from 100% identity to atu:Atu5147)

Predicted SEED Role

"Mg(2+) transport ATPase protein C"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CLM2 at UniProt or InterPro

Protein Sequence (194 amino acids)

>Atu5147 Mg(2+) transport ATPase (Agrobacterium fabrum C58)
MAAVKLPTQRLYGTSFTCQICERNKDATVGDEVWGTLVKEFSDVPDASAITRITVRLVIA
AVLGGVLGFERESKGRSAGLRTHMLVAVGAALFVLGPLQSGMQIGDLSRVLQGVVQGIGF
LGAGAIIIRSAQREVEGLTTAASIWATAAIGVMAGLGMEVTAVLSTAIVLVILAAVPHIL
PTPSETDSKSIGDD