Protein Info for Atu5132 in Agrobacterium fabrum C58

Annotation: ABC transporter membrane spanning protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 37 to 40 (4 residues), see Phobius details amino acids 227 to 250 (24 residues), see Phobius details amino acids 270 to 297 (28 residues), see Phobius details amino acids 326 to 347 (22 residues), see Phobius details PF02687: FtsX" amino acids 229 to 352 (124 residues), 49.7 bits, see alignment E=1.8e-17

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 100% identity to atu:Atu5132)

Predicted SEED Role

"AttF component of AttEFGH ABC transport system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D3U6 at UniProt or InterPro

Protein Sequence (420 amino acids)

>Atu5132 ABC transporter membrane spanning protein (Agrobacterium fabrum C58)
MNWTAFRALLSHWRYRPLQLITLIVGVTLATGLWCAVQAINAEARASYDRAASVLAQNQL
DQLVAKDGGRISSQTYARLRRTGLHVSPIIEGDYRFGTTRIRLIGIDPLTMPSEGMVPAP
SDPSGLVLFIQTPGQMIVSPATAATLKDTSGLSLKARADLPDGAAFVDISTADRLLKRNG
DLSRLIVSPSQDPDLPTIGNIAPELSLEHARSRPDVARLTDSFHLNLTAFGFLAFVVGLF
IVYSATGLSFEQRRGSFRTMRSLGVSLRSLTAMLVIETALFALVSGALGIVVGYVVASAL
LPGVAATLRGLYGASVAGSLSLRPEWWIAGLAMALVGTGLSSLQHLLRVWRMPILSTAQG
GRGRWCPREASSIRRPPGWFCSLYPARLCCWAGGSFQVSQCLQRFFWALHSFFQPCWHWA