Protein Info for Atu5128 in Agrobacterium fabrum C58

Annotation: ABC transporter membrane spanning protein (mannopine)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 31 to 53 (23 residues), see Phobius details amino acids 90 to 114 (25 residues), see Phobius details amino acids 126 to 147 (22 residues), see Phobius details amino acids 156 to 179 (24 residues), see Phobius details amino acids 200 to 223 (24 residues), see Phobius details amino acids 256 to 279 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 106 to 280 (175 residues), 55.4 bits, see alignment E=3.4e-19

Best Hits

KEGG orthology group: K11078, mannopine transport system permease protein (inferred from 100% identity to agr:AGROH133_14710)

Predicted SEED Role

"FIG01075765: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D3V0 at UniProt or InterPro

Protein Sequence (285 amino acids)

>Atu5128 ABC transporter membrane spanning protein (mannopine) (Agrobacterium fabrum C58)
MASDSSTFPVRPSLARPLRNAVGRYRNIVRIYTAGFFVFLITVFLILPTFLVVPMSLNDG
SYLAFPPQGLTLKWYRAYFSDPDWMSATLFSLQVAFATAIVATTIGTTAALALAKSRLPF
KGLLQSLALGPMIVPHVVLGVSLYLVFSPWRVTGTFAGFVLAHTVLAIPYVMIVVGAAVQ
KFDPSLELAALNCGANRFQSFFLVMLPNIGPSVAAASVFAFLASFDDATVSFFISDIGGK
SIGRKMFEDIDFNLTPVIAAASTVLVAISLVLMTAAQLLTTRSRH