Protein Info for Atu5127 in Agrobacterium fabrum C58

Annotation: ABC transporter membrane spanning protein (mannopine)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 30 to 55 (26 residues), see Phobius details amino acids 75 to 101 (27 residues), see Phobius details amino acids 112 to 138 (27 residues), see Phobius details amino acids 162 to 188 (27 residues), see Phobius details amino acids 209 to 256 (48 residues), see Phobius details amino acids 266 to 286 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 96 to 284 (189 residues), 48.9 bits, see alignment E=3.3e-17

Best Hits

KEGG orthology group: K11079, mannopine transport system permease protein (inferred from 100% identity to atu:Atu5127)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8U5W3 at UniProt or InterPro

Protein Sequence (300 amino acids)

>Atu5127 ABC transporter membrane spanning protein (mannopine) (Agrobacterium fabrum C58)
MSASSLASRAIANLQSVMFSTPSAKTYSHAGALLLLLPAALMLLTGFVYPLARLVALSMP
DMSLELYIRIFRDPLYLNVLFSTTVVALAVMCCCLLLGFPVANAMVRLKHPWTLILTGCV
LIPLWTSVLVRSYAWIVLLQRTGIINQALLSTKLIDEPLRMIYTQGAVIVAMTHVLLPFM
IMPIFAALRAIPPEYVQAAMNLGSTRLHAFRAIIVPLSLPGIFAGCVISFVLALGFYVTP
ALVGGAGSLMVATLIGQQTTVLLDWPFAAALSTSLLVVTLAVVIIFRRTLSLSKGLNSGI