Protein Info for Atu5118 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 transmembrane" amino acids 254 to 272 (19 residues), see Phobius details amino acids 285 to 308 (24 residues), see Phobius details PF00155: Aminotran_1_2" amino acids 170 to 403 (234 residues), 55.5 bits, see alignment E=2.8e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu5118)

Predicted SEED Role

"2-amino-3-ketobutyrate coenzyme A ligase (EC 2.3.1.29)" in subsystem Glycine Biosynthesis or Glycine and Serine Utilization (EC 2.3.1.29)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CLN0 at UniProt or InterPro

Protein Sequence (413 amino acids)

>Atu5118 hypothetical protein (Agrobacterium fabrum C58)
MSTDKTQQHASRNTGGLIDHAQDYFNAAHQQGLMALYARPRAARQVDIVFDGFPSQRITD
FVRCSYLGLDNHPLIIDGAIKAIEEYRALHWSCARTRLNFAILRDLENSLSDLFQARVIT
YTTVLAANMGALPIVASGHLTGGIRPMMVFDRHAHATLAFHKGTIALETQVRTLAHNDLD
ALEELCRSNRAVAYVCDGVYSMGGNAPIRDLRYLQDRYGLFLYIDDAHGVSICGKNGEGF
VRSQYGNELGERTIIAASLGKGFGASGGMLMLGTARQEELFRRFAVAHAFSASLNVAAIG
AVSGSLTIHRSDELLRRQLALSSNIALLDSMLVTEQSGAPLPIRTVNLGTEERAVNGTRA
LLDRGIYGSAIFFPTVAKGKAGIRVCVTSDHTPEEITGLCTALSEIMDDQAIS