Protein Info for Atu5060 in Agrobacterium fabrum C58

Annotation: ABC transporter membrane spanning protein (glycerol-3-phosphate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 64 to 87 (24 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 130 to 151 (22 residues), see Phobius details amino acids 172 to 194 (23 residues), see Phobius details amino acids 234 to 255 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 76 to 263 (188 residues), 56.2 bits, see alignment E=1.9e-19

Best Hits

KEGG orthology group: K05815, sn-glycerol 3-phosphate transport system permease protein (inferred from 100% identity to atu:Atu5060)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CLR2 at UniProt or InterPro

Protein Sequence (269 amino acids)

>Atu5060 ABC transporter membrane spanning protein (glycerol-3-phosphate) (Agrobacterium fabrum C58)
MKPENPLLAGLALVAGLLFLSPVLYSIWMSFQTVDAYYAGELGFTLDNYARAVGQYNFAR
YLLNSLIVSAMVTLLGITFATMAAYAFARYSFKGGDFLFAATVATLMIPSHISLIPNYLT
LAKVGLLDSYAGLILPAISNGFAAFFLRQYIRGIPKALDEAAYMDGATSLQVLWRIIVPL
SRPAIASMALYIFMTEWNNYIWPLVAVGKQDMYTLQIGLARLYRINPGEGLIDWPLVMAA
STITILPVLLGFLLVERHLVRGITMGAVK