Protein Info for Atu5059 in Agrobacterium fabrum C58

Annotation: ABC transporter membrane spanning protein (glycerol-3-phosphate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 65 to 91 (27 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 150 to 173 (24 residues), see Phobius details amino acids 204 to 229 (26 residues), see Phobius details amino acids 250 to 276 (27 residues), see Phobius details PF00528: BPD_transp_1" amino acids 85 to 274 (190 residues), 55.2 bits, see alignment E=4e-19

Best Hits

KEGG orthology group: K05814, sn-glycerol 3-phosphate transport system permease protein (inferred from 100% identity to atu:Atu5059)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D407 at UniProt or InterPro

Protein Sequence (289 amino acids)

>Atu5059 ABC transporter membrane spanning protein (glycerol-3-phosphate) (Agrobacterium fabrum C58)
MLRKLTPYLFVAPLMIFIALFTYIPILASLNLSFREWNFLSPNMPFVGFRNYEQLLASRD
LWNSLWVTTLFAVLSVPLRLGLALVIAAYLVRESVHVRLLRGALFLPSVTSTVSIAVVFS
WVFSTDYGMANALLGTFGLGKVQWLQNPHLALWVLIFVNTWKQIGYDIVIYIAGLQAIPR
ELYDAAAVDGGKRLHVFRRITMPLVMPTTYFLLVISVIEAFQVFTIVNVMTKGGPAGATD
MLVSLLYEIGFVLFDIGRGSALAVLLFILLVGLAILKSRIIGRKVHYEA