Protein Info for Atu5041 in Agrobacterium fabrum C58
Annotation: plasmid partitioning protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K03497, chromosome partitioning protein, ParB family (inferred from 100% identity to atu:Atu5041)Predicted SEED Role
"Chromosome (plasmid) partitioning protein ParB" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A9CLS0 at UniProt or InterPro
Protein Sequence (295 amino acids)
>Atu5041 plasmid partitioning protein (Agrobacterium fabrum C58) MTDGLPEIKSIPIDAINVLNPRVRNKKIFNELVTSIAHLGLKRPITVSVRDDNSEYDLVC GQGRLEAFVSLGQTHIPAILVHASVEDCFVMSLVENLARRQHSPLELVREIAVLRDRGYS LTEISTKTDFSEEYVYAVCYLLDHGEERLLAGVEKGIIPASIAMQISRAKDAEVQKALAE AYEQKSIPGNQVLAIRKIVEQRNLSGKTVSGAAYRGDSPRKQVTAAALVRAYQKETERQK MLIKKATLAQSRLLFLVNALRRLIDDEHFTTLLRAEAIKDMPKPLAERLGSGRLQ