Protein Info for Atu4815 in Agrobacterium fabrum C58

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 PF13439: Glyco_transf_4" amino acids 15 to 184 (170 residues), 35 bits, see alignment E=4.4e-12 PF13579: Glyco_trans_4_4" amino acids 15 to 183 (169 residues), 70.5 bits, see alignment E=6.5e-23 PF20706: GT4-conflict" amino acids 189 to 375 (187 residues), 51.4 bits, see alignment E=2.7e-17 PF00534: Glycos_transf_1" amino acids 198 to 362 (165 residues), 113.2 bits, see alignment E=3e-36 PF13692: Glyco_trans_1_4" amino acids 209 to 348 (140 residues), 94.1 bits, see alignment E=2.9e-30 PF13524: Glyco_trans_1_2" amino acids 292 to 377 (86 residues), 38.2 bits, see alignment E=4.3e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu4815)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CH62 at UniProt or InterPro

Protein Sequence (391 amino acids)

>Atu4815 glycosyltransferase (Agrobacterium fabrum C58)
MKIIHVIASIDPKHGGLQAVAMRLAAAQAGLGLDVNIVSYGDAAIEAQVKEIGRSIPHFE
NIHWHLLPPAGRLETLFCFRGRRMLKALLKDASFMHIHGVWEPFLLYASKLARAAGVPYC
ICPAGMLDHWSLGQRSWKKKIALMLCYRRMLNEAAFLHLLNVDEMAAVETLNFQARNLII
PNGVFAEEFDPLPARGHFRQKIALAHGRRYILFLSRLHIKKGIDILASAFAAICETYVDV
DLVVAGPPGGAEGHFMHLVKKLNIRHRVFMVGAIYGKAKLEAMVDADCFCLPSRQEGFSM
AITEALACGTPVVITDQCHFPEVGSADAGLIVSVDAAEVAKALASMLGNPARARTMGENG
RRLVLEKFTWPAIAHATLEGYRLSALEAAAS