Protein Info for Atu4811 in Agrobacterium fabrum C58

Annotation: UDP-phosphate alpha N-acetylglucosaminyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 100 to 125 (26 residues), see Phobius details amino acids 131 to 149 (19 residues), see Phobius details amino acids 160 to 178 (19 residues), see Phobius details amino acids 184 to 202 (19 residues), see Phobius details amino acids 213 to 235 (23 residues), see Phobius details amino acids 242 to 262 (21 residues), see Phobius details amino acids 283 to 310 (28 residues), see Phobius details amino acids 321 to 343 (23 residues), see Phobius details PF00953: Glycos_transf_4" amino acids 75 to 234 (160 residues), 113.9 bits, see alignment E=3.8e-37

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu4811)

Predicted SEED Role

"Undecaprenyl-phosphate N-acetylglucosaminyl 1-phosphate transferase (EC 2.7.8.-)" in subsystem Methicillin resistance in Staphylococci or Teichoic and lipoteichoic acids biosynthesis (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CVX7 at UniProt or InterPro

Protein Sequence (381 amino acids)

>Atu4811 UDP-phosphate alpha N-acetylglucosaminyltransferase (Agrobacterium fabrum C58)
MSGILFNTIATFVLCVSFIVVLRRLTIAFQLVDRPDSIRKRHTGAVPLCGGIAIFAAFAV
SAFVGGWSGALGINFWLGLAVILLMGVVDDRRPLPAAGRLVMQLAMAIALVGGADIGSLS
VGVLFTSHSELFLPLFFFIGVLFVTGLVNSWNMLDGVDGLAGGTAGVALIWLMIVAVFAN
VGDIIPPLEALSVCLCAFLVFNMRGPWRARASIFLGDAGSTALGATIAYVIVLLATTSVS
VSFPALLWIVILPITDTLSLIIRRIMHGRSPMSADRWHFHHLLLDYGFTPAAATNTLIVI
SFLCGGIGFAGIKAGVPAEVMAAGLLLPIALHTAFVLAATGYLSKTLLHRGNFDLYREVV
RLPVVAKSVSEPRAIQSPNEE