Protein Info for Atu4809 in Agrobacterium fabrum C58

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 PF13439: Glyco_transf_4" amino acids 11 to 165 (155 residues), 29.8 bits, see alignment E=1.5e-10 PF20706: GT4-conflict" amino acids 164 to 290 (127 residues), 27.5 bits, see alignment E=3.8e-10 PF00534: Glycos_transf_1" amino acids 178 to 332 (155 residues), 82.6 bits, see alignment E=6.3e-27 PF13692: Glyco_trans_1_4" amino acids 182 to 319 (138 residues), 94 bits, see alignment E=2.5e-30 PF13524: Glyco_trans_1_2" amino acids 258 to 346 (89 residues), 32.3 bits, see alignment E=2.3e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu4809)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CH59 at UniProt or InterPro

Protein Sequence (399 amino acids)

>Atu4809 glycosyltransferase (Agrobacterium fabrum C58)
MKLAYFVIPHIGGTYSVFKHLRKGLAAYDIDVRWLGVCKETYGLPLDLQGETAFGQLLRM
PVNLSERDCAARMAAAIENGGFDGVIVNVLGDQLQTNIARYLPEGILRILVVHNISPGTY
AAARSVRDYAHVTIGVSERCRADLVARNGFPKDRTYAIPNAVDSDAFRSQAVRRVNRGPE
LKVLFVGRIEDASKGVMWLREILDGSPEAVRLTIVGDGPDMGKLRRRLASHDDRVSYAGS
VQLSDIPVIMASHDVLIMPSRFEGLGMTMIEAMAGGCVPVVSHIRGVTDTIVEPGRNGFL
FPIGNYTAAANAIGRLHADRDLLERMSIAGKEMVLNRFSIERMAARYNEVIAMTLNDRPG
LSTVLRMEDWSIPAGLRPGLRTYLPLPLKNWLRVVRERL