Protein Info for Atu4807 in Agrobacterium fabrum C58

Annotation: exopolysaccharide export protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 503 transmembrane" amino acids 7 to 32 (26 residues), see Phobius details amino acids 38 to 58 (21 residues), see Phobius details amino acids 78 to 102 (25 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 224 to 242 (19 residues), see Phobius details amino acids 253 to 271 (19 residues), see Phobius details amino acids 284 to 303 (20 residues), see Phobius details amino acids 322 to 345 (24 residues), see Phobius details amino acids 352 to 372 (21 residues), see Phobius details amino acids 378 to 396 (19 residues), see Phobius details amino acids 408 to 432 (25 residues), see Phobius details amino acids 440 to 461 (22 residues), see Phobius details PF01943: Polysacc_synt" amino acids 9 to 268 (260 residues), 63.1 bits, see alignment E=2.9e-21 PF13440: Polysacc_synt_3" amino acids 28 to 320 (293 residues), 158.3 bits, see alignment E=2.7e-50

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu4807)

Predicted SEED Role

"Lipopolysaccharide biosynthesis protein WzxC" in subsystem Colanic acid biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CVX3 at UniProt or InterPro

Protein Sequence (503 amino acids)

>Atu4807 exopolysaccharide export protein (Agrobacterium fabrum C58)
MHKVRRAFFMAMLEQHLGIAINFALIAIMSRLLSPAEVGFAVIGYGVTAVIFAFREFVSS
DFLIQLDVVERDDINTSLTLLLLVSGILGVVLYLCGPYLALFYHQPGLQHYLVLAIAAVM
AESLGMPAFSMLRRRLAFGTIARVRTIGLVVMAVVTIFAARNGWGFVSFALGLLVGNSVA
SALAAYADPAQRSARLSLKSWRRMAEFGRYRGAATIVDKLYESLPQLVLGFAMTPTAVAI
YNRANTVCSIPDRIFLSAIFSFAFPALAAEVREGGDVRRSYLRALSYITVLYWPSLIMVA
ILADPIVRLALGDQWLAAVPITRILALASIFWFPMVLTTPLLIALNANREAFLGNFVCRS
VSAIVLCSASFFGLTAVALSQFVTLPFQMLVAFYLVRRHAHFKLPELFAAVAPSASVTLA
AIAGPLAISAWMGFRFDYSLAQAGGAVLLSVTGWAAGLFLLRHPLLSEIRSTLDAFTGRR
RKVGKPAAPASIPDTVVSAAVEP