Protein Info for Atu4797 in Agrobacterium fabrum C58

Annotation: glucose-1-phosphate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00483: NTP_transferase
  • amino acids 3 to 230 (228 residues), 40.8 bits, E=1e-14

Best Hits

KEGG orthology group: K00978, glucose-1-phosphate cytidylyltransferase [EC: 2.7.7.33] (inferred from 100% identity to atu:Atu4797)

Predicted SEED Role

"Glucose-1-phosphate cytidylyltransferase (EC 2.7.7.33)" in subsystem dTDP-rhamnose synthesis (EC 2.7.7.33)

MetaCyc Pathways

• CDP-4-dehydro-3,6-dideoxy-D-glucose biosynthesis (1/3 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (2/5 steps found)
• superpathway of CDP-glucose-derived O-antigen building blocks biosynthesis (2/8 steps found)
• streptomycin biosynthesis (3/18 steps found)

KEGG Metabolic Maps

• Nucleotide sugars metabolism
• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.33

Sequence Analysis Tools

See A9CH54 at UniProt or InterPro

Protein Sequence (270 amino acids)

>Atu4797 glucose-1-phosphate cytidylyltransferase (Agrobacterium fabrum C58)
MKVVLFCGGRGTRIREYSESVPKPLIPLGSQPIMRHVMQYYARYGHEDFILCLGYKAHVI
KEFFLNSRPESYADCVISSPGRVELLEELPRDWRVSLIDTGIWRNIGERLWAVRHHLKGE
KMFLANYSDGLTDVDLDDMIAQFEKSDKLACFLAVRPPLTYHLAEIDESGKVREFRSSET
SDMWINGGYFLMRPEIFDYMREGEELVLEPFSRLISEDKLMAYKHEGFWRSMDTLRDWQT
LEAMVERGDMPWIGDDASMARKSSNAKLLP