Protein Info for Atu4789 in Agrobacterium fabrum C58

Annotation: GDP-mannose 4,6-dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01472: GDP-mannose 4,6-dehydratase
  • amino acids 4 to 344 (341 residues), 573.3 bits, E=8.8e-177
• PF01370: Epimerase
  • amino acids 6 to 253 (248 residues), 237.7 bits, E=1.9e-74
• PF04321: RmlD_sub_bind
  • amino acids 6 to 163 (158 residues), 27.7 bits, E=2.2e-10
• PF16363: GDP_Man_Dehyd
  • amino acids 7 to 337 (331 residues), 500.9 bits, E=3.1e-154

Best Hits

Swiss-Prot: 68% identical to GM4D_SINFN: GDP-mannose 4,6-dehydratase (gmd) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K01711, GDPmannose 4,6-dehydratase [EC: 4.2.1.47] (inferred from 100% identity to atu:Atu4789)

MetaCyc: 64% identical to GDP-mannose 4,6-dehydratase (Brucella abortus 2308)
GDP-mannose 4,6-dehydratase. [EC: 4.2.1.47]

Predicted SEED Role

"GDP-mannose 4,6-dehydratase (EC 4.2.1.47)" in subsystem Capsular heptose biosynthesis or Colanic acid biosynthesis (EC 4.2.1.47)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (11/11 steps found)
• GDP-L-fucose biosynthesis I (from GDP-D-mannose) (3/3 steps found)
• GDP-6-deoxy-D-talose biosynthesis (1/2 steps found)
• GDP-D-perosamine biosynthesis (1/2 steps found)
• GDP-D-rhamnose biosynthesis (1/2 steps found)
• GDP-L-colitose biosynthesis (3/5 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (9/14 steps found)
• GDP-N-acetyl-α-D-perosamine biosynthesis (1/3 steps found)
• GDP-N-formyl-α-D-perosamine biosynthesis (1/3 steps found)
• GDP-mycosamine biosynthesis (1/3 steps found)
• superpathway of candicidin biosynthesis (4/11 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.47

Sequence Analysis Tools

See Q7CVV7 at UniProt or InterPro

Protein Sequence (356 amino acids)

>Atu4789 GDP-mannose 4,6-dehydratase (Agrobacterium fabrum C58)
MVDKRALIIGVTGQDGAYLSELLLAKGYMVHGLKRRSSSFNTGRIDHLYQDPFEEDLRFR
LHFGDLTDATNLCRVIQEVQPDEIYNLGAQSHVQVSFETPEYTANADALGTLRLLEAMRI
LNLGDRCRFYQASTSELFGGMGTVAQHEGTPFYPRSPYAAAKLYAYWMTVNYRESYGFHA
SNGILFNHESPIRGETFVTRKITRGVAAIERGLMSKLRLGNLDAKRDWGHARDYVEGMWR
IVQQEIPEDYVLATGEAHTVREFVELAFGVVGKTIEWHGDGSDEVGYDAKTGNSIIEIDP
RYFRPAEVDFLLGDPSKARRKLDWSHSTSFCDLVQEMVEADLRLVMLEEGRNEFVA