Protein Info for Atu4771 in Agrobacterium fabrum C58

Annotation: oxalate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR03404: bicupin, oxalate decarboxylase family" amino acids 44 to 412 (369 residues), 555.8 bits, see alignment E=2.2e-171 PF00190: Cupin_1" amino acids 89 to 220 (132 residues), 79.7 bits, see alignment E=2.7e-26 amino acids 263 to 402 (140 residues), 78 bits, see alignment E=9.1e-26 PF07883: Cupin_2" amino acids 115 to 187 (73 residues), 40.6 bits, see alignment E=2.6e-14 amino acids 295 to 369 (75 residues), 44.4 bits, see alignment E=1.6e-15

Best Hits

Swiss-Prot: 46% identical to OXDC_BACSU: Oxalate decarboxylase OxdC (oxdC) from Bacillus subtilis (strain 168)

KEGG orthology group: K01569, oxalate decarboxylase [EC: 4.1.1.2] (inferred from 100% identity to atu:Atu4771)

MetaCyc: 46% identical to oxalate decarboxylase monomer (Bacillus subtilis)
Oxalate decarboxylase. [EC: 4.1.1.2]

Predicted SEED Role

"Oxalate decarboxylase (EC 4.1.1.2)" (EC 4.1.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CH43 at UniProt or InterPro

Protein Sequence (415 amino acids)

>Atu4771 oxalate decarboxylase (Agrobacterium fabrum C58)
METLTRRAVLAIGAVGGTALAASTAGAASFGNPDQPAEGAINANAAGLSDPGPKNPAIND
QFPSFQSPPATDVGDMQLFWASFNNAAKRIQNGGWARQVTKSDFAISDAVSGVNMRLGPG
GIREMHWHRAAEWAIMTNGRCRITVLDPQGRAYVQDVEAGDLWYFPAGYPHSLQGLGPDG
CEFVIVFDEGDQSEYGTLLLTDWLAHTSPELLAKNFGVAQDVFRNIPLQNLWIFQGKEPG
PLSKDQEAVAGTGLPPFPFTYKLAASKPLKENAAGVIRLADSSAFTVSKTIAAAIETIKP
GGVREMHWHPNADEWQYWIKGEGRMTVFDAGPRSQTADFRAGDIGYVKRSQGHIIENTGK
TDLQFVAVFKAAEYQEVSLSSWLTHTPPALVAQHLNVSIEDVAKFPANQPAIMPG