Protein Info for Atu4753 in Agrobacterium fabrum C58

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 transmembrane" amino acids 18 to 51 (34 residues), see Phobius details amino acids 63 to 85 (23 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 169 to 187 (19 residues), see Phobius details amino acids 193 to 215 (23 residues), see Phobius details TIGR03003: ectoine/hydroxyectoine ABC transporter, permease protein EhuD" amino acids 5 to 222 (218 residues), 374.2 bits, see alignment E=2.2e-116 TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 20 to 117 (98 residues), 96 bits, see alignment E=1.5e-31 PF00528: BPD_transp_1" amino acids 42 to 214 (173 residues), 79 bits, see alignment E=1.9e-26

Best Hits

Swiss-Prot: 59% identical to Y4TG_SINFN: Probable amino-acid ABC transporter permease protein y4tG (NGR_a01520) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to atu:Atu4753)

MetaCyc: 34% identical to cystine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-290 [EC: 7.4.2.12]; 7.4.2.12 [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]

Predicted SEED Role

"putative inner membrane component of binding-protein-dependent transport system"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CH30 at UniProt or InterPro

Protein Sequence (230 amino acids)

>Atu4753 amino acid ABC transporter permease (Agrobacterium fabrum C58)
MMYGYEWDTTTWITYTTSILPIILIGLTVTLKAAAAGFAIALVLGLVFALLRRSRVKLIS
WPTAVVVEFLRDTPLLVQLFFLYYVLPEFGIVLPAFLTGALALGLQYAAYTSEVYRGGME
AVHHGQWEAATALNLTRMQTYRDIIIPQAIPRIVPAMGNYLVAMIKETPVLSVVTVLEMM
GLANMIGERTFEYLVPLTLVGLIFLLLTIICSAGLSRLQRALPKAGIPLR