Protein Info for Atu4752 in Agrobacterium fabrum C58

Annotation: amino acid ABC transporter ATPase/permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 TIGR03005: ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA" amino acids 10 to 258 (249 residues), 468.4 bits, see alignment E=2.3e-145 PF00005: ABC_tran" amino acids 25 to 182 (158 residues), 125.9 bits, see alignment E=1.8e-40

Best Hits

Swiss-Prot: 51% identical to HISP_PSEAE: Histidine transport ATP-binding protein HisP (hisP) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02028, polar amino acid transport system ATP-binding protein [EC: 3.6.3.21] (inferred from 100% identity to atu:Atu4752)

Predicted SEED Role

"amino acid ABC transporter, ATP-binding protein"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.21

Use Curated BLAST to search for 3.6.3.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CH29 at UniProt or InterPro

Protein Sequence (259 amino acids)

>Atu4752 amino acid ABC transporter ATPase/permease (Agrobacterium fabrum C58)
MTNNTNQPLIEFSDVTKRFGILTVLDQFNFSVAKGEKVTLIGPSGSGKSTVLRILMTLEP
FQEGQLKLADISYHQPGGKGPFQASEKHLRQIRNHVGMVFQSFNLFPHMTVLRNIVEAPV
RVLGIARAEAEARAIELLNMVGLADKKDHFPVQLSGGQQQRVAIARSLAMRPRVLLFDEP
TSALDPQLVGEVLSVIRDLAHEHDLTMLLVTHEMRFAREVSDRVCFFDKGRICEQGKPDE
IFGQPKEERTREFLSSVLR