Protein Info for Atu4750 in Agrobacterium fabrum C58

Annotation: D-psicose 3-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 PF01261: AP_endonuc_2" amino acids 22 to 260 (239 residues), 146.4 bits, see alignment E=6.3e-47

Best Hits

Swiss-Prot: 100% identical to DPES_AGRFC: D-psicose 3-epimerase (dpe) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: None (inferred from 100% identity to atu:Atu4750)

MetaCyc: 100% identical to D-psicose 3-epimerase monomer (Agrobacterium fabrum C58)
RXN-14365 [EC: 5.1.3.30, 5.1.3.31]

Predicted SEED Role

"D-tagatose 3-epimerase (EC 5.3.1.-)" in subsystem D-Tagatose and Galactitol Utilization (EC 5.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.-

Use Curated BLAST to search for 5.1.3.30 or 5.1.3.31 or 5.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CH28 at UniProt or InterPro

Protein Sequence (289 amino acids)

>Atu4750 D-psicose 3-epimerase (Agrobacterium fabrum C58)
MKHGIYYSYWEHEWSAKFGPYIEKVAKLGFDIIEVAAHHINEYSDAELATIRKSAKDNGI
ILTAGIGPSKTKNLSSEDAAVRAAGKAFFERTLSNVAKLDIHTIGGALHSYWPIDYSQPV
DKAGDYARGVEGINGIADFANDLGINLCIEVLNRFENHVLNTAAEGVAFVKDVGKNNVKV
MLDTFHMNIEEDSFGDAIRTAGPLLGHFHTGESNRRVPGKGRMPWHEIGLALRDINYTGA
VIMEPFVKTGGTIGSDIKVWRDLSGGADIAKMDEDARNALAFSRFVLGG