Protein Info for Atu4747 in Agrobacterium fabrum C58

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 39 to 62 (24 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 100 to 124 (25 residues), see Phobius details amino acids 131 to 149 (19 residues), see Phobius details amino acids 169 to 190 (22 residues), see Phobius details amino acids 221 to 240 (20 residues), see Phobius details amino acids 252 to 270 (19 residues), see Phobius details amino acids 276 to 296 (21 residues), see Phobius details amino acids 303 to 325 (23 residues), see Phobius details PF02653: BPD_transp_2" amino acids 46 to 314 (269 residues), 109.8 bits, see alignment E=7e-36

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to atu:Atu4747)

Predicted SEED Role

"Ribose/xylose/arabinose/galactoside ABC-type transport systems, permease component 1" in subsystem D-ribose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CH27 at UniProt or InterPro

Protein Sequence (331 amino acids)

>Atu4747 sugar ABC transporter permease (Agrobacterium fabrum C58)
MNSLIRKFNAIFGADMAGPVIALIAVMLIFGTFADNFLSLATFGSVAFQLPELGLLTLAM
LLPLLTGGINLSVTFAANLSGLAAAWVLQAHGGVDAPPSAFLFACLAALVTGGAAGAMTG
AAIAYTRAHPILVTLSMMIFLRGLGEFLTRGGDVSGFPAYMAPLGHGTLLGLPIPLLIFI
VCVGIWHVLLTRTKLGFGLLMIGSNIEAARYSGLNTRKIQVLVYTLSGLMCAVAGIIMLA
RFNSVRVGHGESYLLITVLAAFLGGINPFGGFGRVLPVFVALIVLQLLSSGLNLLGANQH
LATALWGVLMIVVMAARGLFSSYFASLRKKV