Protein Info for Atu4746 in Agrobacterium fabrum C58

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 67 to 87 (21 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 267 to 286 (20 residues), see Phobius details amino acids 296 to 316 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 38 to 311 (274 residues), 120.9 bits, see alignment E=2.9e-39

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to atu:Atu4746)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CH26 at UniProt or InterPro

Protein Sequence (338 amino acids)

>Atu4746 sugar ABC transporter permease (Agrobacterium fabrum C58)
MRRLILGHTTEFTLLVVMVLLCTGLSFATDRFLTISNAFDVLNVSAVNIIFAVGLLVVLI
SGGIDISFAVAASVVQYVTVLALNALGGGNWAEGFIIAGAVGLSLGFVNAFLVWRLNIIS
IVATISTFNIFFGLLMFFTKGVSIYDLPEWLSTRVVFYEREMPDGSWVELTLPVVVMILC
CVATWFMISRTTVGRKLYAFGDNPEGARRFGINIGAMHYISFGWLGLMAGIAGLMQAHYA
QEVVPNALYGRELDVLAATVLGGARLGGGKGSVIGCVLGVLMVSITQNGLNLMGVSPFAF
KMIVGAIILVAITLSSTRFDKLLPSALRTSAKKGSAQR