Protein Info for Atu4726 in Agrobacterium fabrum C58

Annotation: superoxide dismutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF00081: Sod_Fe_N" amino acids 36 to 118 (83 residues), 69 bits, see alignment E=4e-23 PF02777: Sod_Fe_C" amino acids 126 to 228 (103 residues), 96.9 bits, see alignment E=6.5e-32

Best Hits

Swiss-Prot: 42% identical to SODF_LEGPH: Superoxide dismutase [Fe] (sodB) from Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)

KEGG orthology group: K04564, superoxide dismutase, Fe-Mn family [EC: 1.15.1.1] (inferred from 100% identity to atu:Atu4726)

Predicted SEED Role

"Superoxide dismutase [Fe] (EC 1.15.1.1)" in subsystem Oxidative stress (EC 1.15.1.1)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.15.1.1

Use Curated BLAST to search for 1.15.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CVP7 at UniProt or InterPro

Protein Sequence (231 amino acids)

>Atu4726 superoxide dismutase (Agrobacterium fabrum C58)
MDITRRTILTAGAATATVAIFPRPHVAQAALPLTQPKLPFAEADLAPVISARTVGLHYGK
HHKAYFDKLNTLAAGTRYADMELAGIVKESAGSKAAADVKIFNNAAQAWNHVAYWDQFVP
GGPNRPTGDLAASLNETFGDYDGFIKRAVDVSDTVFGTGWVWLTRDDDNKLALIGYEDGN
NPVAVGRPAYLGIDIWEHAYYLDYENRKPDHIRAVLDKLVNWRVVEERLKA