Protein Info for Atu4679 in Agrobacterium fabrum C58

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 transmembrane" amino acids 23 to 46 (24 residues), see Phobius details amino acids 53 to 76 (24 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 145 to 170 (26 residues), see Phobius details amino acids 192 to 215 (24 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 15 to 112 (98 residues), 103.5 bits, see alignment E=3.7e-34 PF00528: BPD_transp_1" amino acids 36 to 219 (184 residues), 48.6 bits, see alignment E=4.1e-17

Best Hits

KEGG orthology group: K10040, putative glutamine transport system permease protein (inferred from 100% identity to atu:Atu4679)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGZ6 at UniProt or InterPro

Protein Sequence (221 amino acids)

>Atu4679 amino acid ABC transporter permease (Agrobacterium fabrum C58)
MFNYTFHWNQALKALPQLLDGAVVTLQIAILSMVIGLSFAILLTLFRLSGNRVLGAFAAV
WVEIARNTPALFQIYMAHFGLGNFGIHLSPYTALLVGIAFNNAGYLAENFRGALKAIPDT
QTRSGRSLGMTSMQTFRLIIMPQMLRVAFLPATNQMVWAILMTSLGVTVGMNTDLAGVTQ
ALNARSFRTFEFFALAAVIYYVIAKIVTLAARLLAARLFRY