Protein Info for Atu4668 in Agrobacterium fabrum C58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 176 to 200 (25 residues), see Phobius details amino acids 226 to 248 (23 residues), see Phobius details amino acids 257 to 282 (26 residues), see Phobius details amino acids 288 to 306 (19 residues), see Phobius details amino acids 318 to 338 (21 residues), see Phobius details amino acids 345 to 364 (20 residues), see Phobius details PF12679: ABC2_membrane_2" amino acids 14 to 369 (356 residues), 55.7 bits, see alignment E=7e-19 PF12698: ABC2_membrane_3" amino acids 26 to 364 (339 residues), 122 bits, see alignment E=4.9e-39 PF01061: ABC2_membrane" amino acids 183 to 337 (155 residues), 88.2 bits, see alignment E=8.7e-29

Best Hits

Swiss-Prot: 62% identical to YHHJ_SHIFL: Inner membrane transport permease YhhJ (yhhJ) from Shigella flexneri

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 100% identity to atu:Atu4668)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGZ2 at UniProt or InterPro

Protein Sequence (372 amino acids)

>Atu4668 ABC transporter permease (Agrobacterium fabrum C58)
MRLFSSNIFQLGIKELRGLARDGMLLLLIVYAFTLQIYTGSSALPETLNNAAIAIVDEDQ
SPLSGRISTAFYPPYFAPPKQISIAEMDKRMDAGLDTFALNIPPDFQRRLMAGQQPAIQL
NIDATRMSQAFSGGGYVQNIVTSEVQEYVNRYRGATTVPVDLTLRSRFNPELDKSWFGSI
NNIITAITMLSIVLTGAALIREREHGTVEHLLVMPVTPLEIMLSKVWSMGLVVLVASAFS
LFVVVKGLLAIPIEGSLSLFLLGTALQLFAMTSMGIFLATVAGSMPQFGMLLILFLLPLQ
VLSGAMTPRESMPDIIQYIMLLAPNTHFVILAQSVLFRGGGLDVVWPQLLALLAIGSALF
IFALRRFRRFLR