Protein Info for Atu4657 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 112 to 129 (18 residues), see Phobius details amino acids 136 to 153 (18 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details amino acids 217 to 237 (21 residues), see Phobius details amino acids 247 to 267 (21 residues), see Phobius details amino acids 273 to 296 (24 residues), see Phobius details PF00892: EamA" amino acids 23 to 152 (130 residues), 52.1 bits, see alignment E=4.4e-18 amino acids 162 to 286 (125 residues), 44.9 bits, see alignment E=7.1e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu4657)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGY8 at UniProt or InterPro

Protein Sequence (303 amino acids)

>Atu4657 hypothetical protein (Agrobacterium fabrum C58)
MNGDGQSEKQENPRETDTRAGVGWLLLDMTLVSGGMTALVKAQGVTYPAFQLVFIRAMVG
LIFILPLIWRHRGEMVRVKYPWRNLFRICCNAIALTSNFIAITLLPLATVNAVGFSRPLV
TMAMAVAFLGETVSRFRWVGASLAFVGVLVVIGPDGAEFGVGVLVVLVSVVFGALAVIQT
RALRQENTTVMMVFYTVGLAVITAIPAIWTWKPVASFDWVALLGIGLLAQMGQYCFLRAY
RIADASVLAPVGYLSILFVTAVGYFLFDEVPENRVVLGIAIILVSLQSTALAEYLLKRLR
RRR