Protein Info for Atu4621 in Agrobacterium fabrum C58

Annotation: dipeptide ABC transporter ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 PF00005: ABC_tran" amino acids 28 to 185 (158 residues), 74.2 bits, see alignment E=8.4e-25

Best Hits

Swiss-Prot: 43% identical to DPPD_ECOLI: Dipeptide transport ATP-binding protein DppD (dppD) from Escherichia coli (strain K12)

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to atu:Atu4621)

MetaCyc: 43% identical to dipeptide ABC transporter ATP binding subunit DppD (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Oligopeptide ABC transporter, ATP-binding protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CVF1 at UniProt or InterPro

Protein Sequence (281 amino acids)

>Atu4621 dipeptide ABC transporter ATPase (Agrobacterium fabrum C58)
MPAPDSSPILSVRNLNVRFGRNSIPAVSDVSFDVGRERVGIVGESGSGKSTTGRAAMRLL
PKSATVTAERMDFLSQPLLEKSERQMGAIRGSEMALIMQDPRYSLNPVLPIGKQVAEAAE
MHLALKGAAARDAARNMLLRVRISDPDRVMGLYPHQISGGMGQRVMIAMMLLAKPKLVIA
DEPTSALDVSVRKDVLLLLDEMVRENDAGLILISHDIRMVAAFCERVLVMYGGRVVETLT
KLEDAQHPYTRGLIAAMPDPRNPVRRLKVLDRQAIDAEVLR