Protein Info for Atu4602 in Agrobacterium fabrum C58

Annotation: IS426 transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 129 PF01527: HTH_Tnp_1" amino acids 16 to 94 (79 residues), 83.5 bits, see alignment E=4.8e-28

Best Hits

Swiss-Prot: 49% identical to INSC_SHIFL: Transposase InsC for insertion element IS2 (insC1) from Shigella flexneri

KEGG orthology group: K07483, transposase (inferred from 99% identity to oan:Oant_4642)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CVD5 at UniProt or InterPro

Protein Sequence (129 amino acids)

>Atu4602 IS426 transposase (Agrobacterium fabrum C58)
MSNDYRHVELLTGDVRRRRWTTEQKLTIIEQSFEPGETVSSTARRHGVAPNLLYRWRRLL
SEGGAAAVDSDEPVVGNSEVKKLEDRVRELERMLGRKTMEVEILREALSKADSKKRISRP
ILLPKDGSR