Protein Info for Atu4588 in Agrobacterium fabrum C58

Annotation: sodium bile acid symporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 36 to 57 (22 residues), see Phobius details amino acids 69 to 92 (24 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 126 to 150 (25 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details PF13593: SBF_like" amino acids 14 to 207 (194 residues), 66.9 bits, see alignment E=1.9e-22 PF01758: SBF" amino acids 43 to 207 (165 residues), 152.2 bits, see alignment E=1.4e-48

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu4588)

Predicted SEED Role

"Sodium-dependent transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGV1 at UniProt or InterPro

Protein Sequence (207 amino acids)

>Atu4588 sodium bile acid symporter family protein (Agrobacterium fabrum C58)
MKTLASLSAFVGKTFAIWVILFAVLGFFFPETFRQIAPWIVTLLSIIMFGMGLTLSVDDF
REVVKRPFDVTIGVLGQFLIMPLLAVLLTRIIPMPPEVAAGVILVGCCPGGTSSNVMTYL
SKGDVALSVACTSVTTLAAPLVTPFLVWLFASQFLPVDGWAMFLSIVKVVLLPLALGAAL
QKLVPGIVKAAVPALPLVSVIGIVLIV