Protein Info for Atu4578 in Agrobacterium fabrum C58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 PF00005: ABC_tran" amino acids 19 to 161 (143 residues), 121.2 bits, see alignment E=9.9e-39 PF08402: TOBE_2" amino acids 273 to 351 (79 residues), 28.3 bits, see alignment E=3.2e-10

Best Hits

KEGG orthology group: K02010, iron(III) transport system ATP-binding protein [EC: 3.6.3.30] (inferred from 100% identity to atu:Atu4578)

Predicted SEED Role

"Ferric iron ABC transporter, ATP-binding protein" in subsystem Iron acquisition in Vibrio or Transport of Iron

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.30

Use Curated BLAST to search for 3.6.3.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CVB2 at UniProt or InterPro

Protein Sequence (361 amino acids)

>Atu4578 ABC transporter permease (Agrobacterium fabrum C58)
MAAVEITSIKKSYRDVVALSDINISIPSGSFFTLLGPSGCGKTTLLRTIAGFHQQDSGSI
SIERQAIEHVPAHKRDVGMVFQDYAVFPHISVFDNIAFGLKQRKSSSAEIRERVGKILDV
VQLAPYAKRMPHELSGGQQQRVGLARALVINPKVLLMDEPLSNLDAKLRVDLRRELREIQ
QAMNITTVYVTHDQEEALAMSDLVCVMYGGVIQQAAPPWEVYNNPANRFVASFVGANNFL
TLDRTGGQTSISSLKVTLPQADAISKDRTIVAAIRPEAISIGPSIGNCDERIELPVTIRQ
VSFTGREMNVAAVLSSGEEIEAITKPSPEIIALQPNQKTTFSWFAGDTQLFGDGVTGERL
S