Protein Info for Atu4570 in Agrobacterium fabrum C58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 147 to 173 (27 residues), see Phobius details amino acids 194 to 216 (23 residues), see Phobius details amino acids 250 to 271 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 83 to 275 (193 residues), 75.1 bits, see alignment E=3.1e-25

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to atu:Atu4570)

Predicted SEED Role

"Putrescine transport system permease protein PotH (TC 3.A.1.11.2)" in subsystem Polyamine Metabolism (TC 3.A.1.11.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CVA4 at UniProt or InterPro

Protein Sequence (284 amino acids)

>Atu4570 ABC transporter permease (Agrobacterium fabrum C58)
MAGLLRDRRAQLLLLLLPGVGYLLVFFGGPLLSALIGSFRQEDGSFTLMFYQRIFTRASM
IRGLTTSIYYGVMPVIVSLAASVPLALLIRRSFLGRKLFSGLYKLPMAVPGIIVGLMVIV
VFERGGFLDRLVAPLGLELPKLVRDGWGIGVILASVWKQIPFMTLIITSAFAAIPEDIRY
ALRTLGASRLKTFFFVEVPLAMPGITAAILLTFIGSMGSYAIPDIVGPPTARPLSVLMIQ
EFNQGRFNQVYAMGMILSLFAVTVLILYYSLTSRIGPGQNRGDA