Protein Info for Atu4568 in Agrobacterium fabrum C58

Annotation: ABC transporter substrate binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF01547: SBP_bac_1" amino acids 62 to 348 (287 residues), 51.7 bits, see alignment E=1.3e-17 PF13416: SBP_bac_8" amino acids 71 to 366 (296 residues), 65.7 bits, see alignment E=6.3e-22

Best Hits

KEGG orthology group: K02027, multiple sugar transport system substrate-binding protein (inferred from 100% identity to atu:Atu4568)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGU1 at UniProt or InterPro

Protein Sequence (409 amino acids)

>Atu4568 ABC transporter substrate binding protein (Agrobacterium fabrum C58)
MRLKFFAIAALALATTAAPCLSADSNMKNLDFDLSKVTRDNFYDIVVPAAKAEGKVTMYN
FAGSFADTWKELITRFEAKYGIKVAYSDVKGDQANQQLIAVQAAGQDSPVDAYFAGGGSY
PLLSSKGVVGNIALTKILPNMANYNPELAETVFGKPHGGSFPLVHLNQTAIGYHSAFVKA
EDVPKSFEDLLVWAEKNPKRLGVTLPAKGGSGGGFIYSVALNYLTGDCRKQLTDYNQTLQ
QAEDWAMESECLTPVWDYYRRLLAVAELTNGNADTLNLINNQQLYMGTVWEDQVMSFLGT
KQLPDSFRVTLLEKGQVGSGDAMFVPANAKNVASALLLIDMAMSKEFQLWKLENKASRSP
RTDVTNDLMPKAVQEHVLPQSVYPRLSLPAFWDMSTALAEALDEKVLNQ