Protein Info for Atu4559 in Agrobacterium fabrum C58

Annotation: sugar ABC transporter ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 PF00005: ABC_tran" amino acids 19 to 161 (143 residues), 122.9 bits, see alignment E=2.3e-39 PF17912: OB_MalK" amino acids 235 to 288 (54 residues), 33.9 bits, see alignment 7.2e-12 PF08402: TOBE_2" amino acids 282 to 350 (69 residues), 22.3 bits, see alignment E=1.8e-08

Best Hits

Swiss-Prot: 52% identical to MALK_VIBPA: Maltose/maltodextrin import ATP-binding protein MalK (malK) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: K02023, multiple sugar transport system ATP-binding protein (inferred from 100% identity to atu:Atu4559)

MetaCyc: 60% identical to polyol ABC-type transporterATP-binding component MtlK (Pseudomonas fluorescens)
7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]

Predicted SEED Role

"Various polyols ABC transporter, ATP-binding component" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CV95 at UniProt or InterPro

Protein Sequence (367 amino acids)

>Atu4559 sugar ABC transporter ATPase (Agrobacterium fabrum C58)
MGSLKLENLNKAFGAVHVLHDIDLQIENGEFVVFVGPSGCGKSTLLRIIAGLEDVSSGTI
GIGGRDVSALSPAERKIAMVFQSYALYPHMSVRKNLAFGLENLRFKRAEIESRINEAARM
LAIEPYLDRKPKQLSGGQRQRVAIGRAIVREPDIFLFDEPLSNLDAALRVQTRAEITRLH
RDIKTTMIYVTHDQVEAMTMADKIVVLRAGRIEQVGSPLELFDNPRNLFVAGFLGSPRMN
MLKGTITKGEDGNIAIDAGYGVSLPCLVDPATVSPGQPVLAGIRPSHFAIADAGLPFEVQ
YHESLGTETYLYGNLQGEKEQIIVHQAGHFAPASGSVLKIMPAREKVHVFDPATELALPR
AASEGRG