Protein Info for Atu4558 in Agrobacterium fabrum C58

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 40 to 65 (26 residues), see Phobius details amino acids 111 to 133 (23 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details amino acids 194 to 217 (24 residues), see Phobius details amino acids 239 to 261 (23 residues), see Phobius details amino acids 300 to 321 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 124 to 329 (206 residues), 52.4 bits, see alignment E=2.9e-18

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to atu:Atu4558)

Predicted SEED Role

"sugar ABC transport system, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CV94 at UniProt or InterPro

Protein Sequence (331 amino acids)

>Atu4558 sugar ABC transporter permease (Agrobacterium fabrum C58)
MANPTLARLSDRALDAVMAIAEVPLNFIERLIGKRRMPYIFLMPNLVLFGIFTFLPIAIA
VGYAFTGGTELLISDRPFVGLENFGKLLDCQSYMDPGSCRESLFWTAIWNTLWFVAFNVV
ATLLVALITALILNRAIAARGFFRAMFFYPVLLSPVVIGLIWKWFLDRNGLLNAFFQMLG
VPPEIFLLDVGWSRFFVVVVSVWFHMGFYTLILLAGLQAIPKDLYEAAAIDAASPRRTLL
RITLPLLGPNLLVVLILLMIRSVQIFDEAWVLTNGGGPGTANTFVVQYIYQMAFGSDLRL
FGLASAASVLMGLVLLALTLVQLRLGKKMES