Protein Info for Atu4537 in Agrobacterium fabrum C58

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 transmembrane" amino acids 17 to 44 (28 residues), see Phobius details amino acids 56 to 80 (25 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details amino acids 147 to 171 (25 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 14 to 111 (98 residues), 99.5 bits, see alignment E=6.6e-33 PF00528: BPD_transp_1" amino acids 40 to 214 (175 residues), 78.9 bits, see alignment E=2.1e-26

Best Hits

Swiss-Prot: 38% identical to GLNP_BACSU: Probable glutamine ABC transporter permease protein GlnP (glnP) from Bacillus subtilis (strain 168)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to atu:Atu4537)

Predicted SEED Role

"polar amino acid ABC transporter, inner membrane subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CV74 at UniProt or InterPro

Protein Sequence (222 amino acids)

>Atu4537 amino acid ABC transporter permease (Agrobacterium fabrum C58)
MSYSLDFSAVIERLPELLLACLATIGLAIAGMSLATVLGVLGVVARRSRFKLLRGLVIGF
VEAIRNTPFLVQIFFIFFALPQIGIKLNPTVTAIIALALNGGAYAIEIIRGGVDSIPKGQ
VEAGLALGLHRAQIFRHIILKPALRAVYPSLTSQFIMLTLTTSVCTSIAAYELTSVAQKI
EADTFRSFEVYFSITLLYLVISSLMMGIFALISRASFSYPVK