Protein Info for Atu4521 in Agrobacterium fabrum C58

Annotation: AraC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 PF12833: HTH_18" amino acids 24 to 102 (79 residues), 58.4 bits, see alignment E=1.4e-19 PF06445: GyrI-like" amino acids 127 to 272 (146 residues), 116.3 bits, see alignment E=3.2e-37 PF14526: Cass2" amino acids 133 to 272 (140 residues), 82.8 bits, see alignment E=6.1e-27

Best Hits

KEGG orthology group: K13653, AraC family transcriptional regulator (inferred from 100% identity to atu:Atu4521)

Predicted SEED Role

"transcriptional regulatory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGS4 at UniProt or InterPro

Protein Sequence (274 amino acids)

>Atu4521 AraC family transcriptional regulator (Agrobacterium fabrum C58)
MPALDKLIWQIETDLNKDLTLTVLSDRCAISTHHMCRLFQLSTGLSIMSYVRARRLSMAA
DTIARHDGDILTAALDAGYGSHEAFTRAFANYFNALPSTVRKARSTSSLDLMEPLKMKND
MFVEVQPPEMRRADAFMVVGLSTPCSLENNSTIPALWQRFNLRESEVEEVVSGAAYGVCS
AADEAGNCTYLAGVKALTKTPGMDYIELPAQSYAVFTHNGHISDLPRTVYTIWNKALPEA
GLKTADSPDFERYDQRFNPETGRGSVEIWIPVIA