Protein Info for Atu4511 in Agrobacterium fabrum C58

Annotation: acetolactate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 608 transmembrane" amino acids 82 to 102 (21 residues), see Phobius details TIGR04377: 3,5/4-trihydroxycyclohexa-1,2-dione hydrolase" amino acids 5 to 606 (602 residues), 914.6 bits, see alignment E=1.7e-279 PF02776: TPP_enzyme_N" amino acids 14 to 119 (106 residues), 43 bits, see alignment E=5.3e-15 PF00205: TPP_enzyme_M" amino acids 217 to 350 (134 residues), 118.8 bits, see alignment E=2.2e-38 PF02775: TPP_enzyme_C" amino acids 413 to 564 (152 residues), 121 bits, see alignment E=6e-39

Best Hits

KEGG orthology group: K03336, 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [EC: 3.7.1.-] (inferred from 100% identity to atu:Atu4511)

Predicted SEED Role

"Epi-inositol hydrolase (EC 3.7.1.-)" in subsystem Inositol catabolism (EC 3.7.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGS0 at UniProt or InterPro

Protein Sequence (608 amino acids)

>Atu4511 acetolactate synthase (Agrobacterium fabrum C58)
MKTIRLTAAQAMVRYLAAQMNEHGETYIAGVWAIFGHGNVAGIGEALYGIRDELPTYRGQ
NEQSMAHAAIAYSKQLRRRRAMAVTSSIGPGAANMVTAAALAHVNRLPVLLIPGDVFANR
GPDPVLQQLEDFGDGTMTVNDCFRPVSRYFDRIMRPEQLLTALPRAMRTMTDPADCGPVT
LAFCQDVQAEAYDYPVSFFEKRIWRQRRPEPDVVEFEEALAALKAAKNPVIVAGGGVHFA
GATETLKRFAETHSIPVVETQAGKSALAWDHDLNFGPVGVTGAESANIVSEKADLVFGVG
TRFQDFTTGSWALFKNPSRKILALNVQPYDSAKHDAISLTADAKIGLEKLSAALGSHRYA
APDAGLKAAWFEKADADTAAPGEEHVNSLPTDMQVIGAVQRQSRDNTVVMCAAGTMPGEL
HQLWKSKLPLSYHMEYGFSCMGYEVAGGLGIKMAEPDRDVIVMVGDGSYMMMNSELATSV
AMGVKITLVITDNRGYGCINRLQMETGGAEFNNLYAHTNVNPIAIDFVAHAGSMGADARK
VSTITELEEALAAARASSRTTVVVIDTDPYPTPQAGGHWWDVAVPEVSDRAEIGPARARY
ENHVKERQ