Protein Info for Atu4493 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 PF01928: CYTH" amino acids 3 to 135 (133 residues), 73 bits, see alignment E=1.5e-24

Best Hits

Swiss-Prot: 44% identical to 3PASE_CLOTH: Inorganic triphosphatase (Cthe_2577) from Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)

KEGG orthology group: None (inferred from 100% identity to atu:Atu4493)

Predicted SEED Role

"COGs COG2954"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGR0 at UniProt or InterPro

Protein Sequence (162 amino acids)

>Atu4493 hypothetical protein (Agrobacterium fabrum C58)
MAKEIERKFLVAGGEWRDEVTHSMAFRQAYVASLENRSVRVRIVDGRDATLTIKIGASAL
VRDEYEYSIPLKDAEELMASAPGVVIEKTRHTVDHGGFTWEVDVFEGQYRGLVVAEVEMN
DENANPDLPSWLGREVTGDKRFSNQSLAMDCPNGDLSDALQN