Protein Info for Atu4491 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 PF17773: UPF0176_N" amino acids 17 to 107 (91 residues), 98.1 bits, see alignment E=3.2e-32 PF00581: Rhodanese" amino acids 131 to 222 (92 residues), 42.2 bits, see alignment E=9.1e-15

Best Hits

Swiss-Prot: 100% identical to Y4491_AGRFC: UPF0176 protein Atu4491 (Atu4491) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K07146, UPF0176 protein (inferred from 100% identity to atu:Atu4491)

Predicted SEED Role

"Rhodanese domain protein UPF0176, cyanobacterial/alphaproteobacterial subgroup"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8U7F8 at UniProt or InterPro

Protein Sequence (314 amino acids)

>Atu4491 hypothetical protein (Agrobacterium fabrum C58)
MTDTTILPRPEVSGDFLVAALYHFARLPRFESLREQLFELCQKNGVKGTLLLAAEGINGT
IAGPDAGVQAVLSFLRAQPEFAALEHKESRASHMPFVRLKVKLKKEIVTMGVPDIDPNRI
VGTYVDPRDWNALISDPDTIVIDTRNDYETAIGVFKGAVDPQTKTFREFPDWVKNNPGLH
NKPKIAMYCTGGIRCEKATAFMKEQGFDEVYHLKGGILKYLEEVPEEESLWEGACFVFDE
RVSVVHGLAEGDHQLCHACRNPITPDVRLSPKFEEGVSCPSCYDERSEDDRQRFRDRQQQ
IELAKTRGERHLGR