Protein Info for Atu4478 in Agrobacterium fabrum C58

Annotation: multidrug resistance efflux pump

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 transmembrane" amino acids 82 to 102 (21 residues), see Phobius details PF16576: HlyD_D23" amino acids 118 to 362 (245 residues), 59.9 bits, see alignment E=5.6e-20 PF13533: Biotin_lipoyl_2" amino acids 123 to 167 (45 residues), 52.6 bits, see alignment 7.5e-18 PF00529: CusB_dom_1" amino acids 190 to 413 (224 residues), 45.6 bits, see alignment E=1.3e-15 PF13437: HlyD_3" amino acids 286 to 365 (80 residues), 59.8 bits, see alignment E=1e-19

Best Hits

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 100% identity to atu:Atu4478)

Predicted SEED Role

"Multidrug resistance protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CV21 at UniProt or InterPro

Protein Sequence (432 amino acids)

>Atu4478 multidrug resistance efflux pump (Agrobacterium fabrum C58)
MCQERDYVNRTERFSSKTFFNLSRYNLMSAQKNSAVRAVNDAEEADISAKAETSPAKPAD
APPQATPAPAVAAPKAKKRSPLLPIFALALLVGAGWYGYNWWIDGRFMVSTDDAYIQGDI
AVIAPKVAGYVAKVNVVENQEVKAGDPLVTLDDGDYRIAFEQADAQIRTEQLSLKRIDAQ
IIGGEAAQEQAVAQKGALDAALRGAEITQKRATELQAKDVGTVAASDNAQVALDQARANV
VAGEAAISSAKANVELLRAQREEAESTIRSLQLSKDKAARDLAFTVLKAPYDGVIGNLAV
QTGDLVSVGKRLASLVPMNELYIDANFKETQLARVVPGSKVRVHVDAFDDEAIEGTVQSI
SPGSGSVFSMLPPENATGNFTKVIQRVPVRIVFSKEDLAKHNLRAGLSVVVDVDTRTAPE
NTRTAQVNPQAK