Protein Info for Atu4457 in Agrobacterium fabrum C58

Annotation: endonuclease III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 TIGR01083: endonuclease III" amino acids 35 to 224 (190 residues), 270.4 bits, see alignment E=3.8e-85 PF00730: HhH-GPD" amino acids 64 to 198 (135 residues), 74.2 bits, see alignment E=1.5e-24 PF00633: HHH" amino acids 130 to 157 (28 residues), 37.8 bits, see alignment (E = 1.6e-13) PF10576: EndIII_4Fe-2S" amino acids 217 to 233 (17 residues), 27.6 bits, see alignment (E = 4.3e-10)

Best Hits

Swiss-Prot: 46% identical to END3_BUCAI: Endonuclease III (nth) from Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)

KEGG orthology group: K10773, endonuclease III [EC: 4.2.99.18] (inferred from 100% identity to atu:Atu4457)

Predicted SEED Role

"Endonuclease III (EC 4.2.99.18)" in subsystem Control of cell elongation - division cycle in Bacilli or DNA Repair Base Excision (EC 4.2.99.18)

Isozymes

Compare fitness of predicted isozymes for: 4.2.99.18

Use Curated BLAST to search for 4.2.99.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CV04 at UniProt or InterPro

Protein Sequence (260 amino acids)

>Atu4457 endonuclease III (Agrobacterium fabrum C58)
MTVAKKRSSTQTLKKSIPAQRRKPVRVKTAYSKDELTEIFRRFSIQRPEPKGELEHTNPF
TLLVAVALSAQATDVGVNRATRALFKVADTPEKMLALGEEQLIGHIKTIGLYRNKAKNVI
ALSQMLIDNFGGEVPKTREELVTLPGVGRKTANVVMSMAFGVPTLAVDTHVFRIANRLCL
APGKTTDEVEDRLVRIIPEQYLFHAHHWLILHGRYCCKARKPECERCVIADICKSPEKTF
DIPAPLVELPAQLFGAAGGE